PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00131995001
Common NameGSBRNA2T00131995001, LOC106402384
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 344aa    MW: 38387.3 Da    PI: 8.993
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00131995001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.31.7e-333488155
              G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                         kprlrWt eLH+rFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  GSBRNA2T00131995001 34 KPRLRWTVELHDRFVDAVAQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRL 88
                         79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.333191IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.0E-323189IPR009057Homeodomain-like
SuperFamilySSF466892.15E-163389IPR009057Homeodomain-like
TIGRFAMsTIGR015577.9E-243489IPR006447Myb domain, plants
PfamPF002494.7E-83686IPR001005SANT/Myb domain
PfamPF143791.8E-21129169IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MFHAKKPSSM NGSYENRAMC VQGDSGLVLT TDPKPRLRWT VELHDRFVDA VAQLGGPDKA  60
TPKTIMRVMG VKGLTLYHLK SHLQKFRLGK QPHKEYGDHS TKEGSRASVM DIQRNVASSS  120
GMISRNMNEM QMEVQRRLHE QLEVQRHLQL RIEAQGKYMQ SILERACQTL AGENMAAAAV  180
VQGGGYKGNL GSSSLSAAMG SSPHPLSFPP FQDLNIYGNT TEQVLDHHNF HHQNIENHYT  240
GNNAADTNIY LGKRRPSPSF GNDVRKELLM WSDHDQDLSV NQPFDDEHRI QIQMATHIST  300
DLDSLSEHNR GKLLERLSPR RSPVSPMMNP NGGLIQGMNS PFG*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00131995001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3167190.0AK316719.1 Arabidopsis thaliana AT1G79430 mRNA, complete cds, clone: RAFL09-57-C07.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013589956.10.0PREDICTED: myb family transcription factor APL-like
RefseqXP_013698554.10.0PREDICTED: myb family transcription factor APL-like
SwissprotQ9SAK50.0APL_ARATH; Myb family transcription factor APL
TrEMBLA0A078CTE30.0A0A078CTE3_BRANA; BnaC06g19840D protein
TrEMBLA0A0D3CVT60.0A0A0D3CVT6_BRAOL; Uncharacterized protein
STRINGBra003611.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50442750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79430.20.0G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]